

Database Accession: DI4000001
Name: Cladosporin in complex with human lysyl-tRNA synthetase
PDB ID: 4ycu
Experimental method: X-ray (2.10 Å)
Source organism: Homo sapiens
Proof of disorder:
Kd: 3.30×10-06 M
Primary publication of the structure:
Fang, P., Han, H., Wang, J., Chen, K., Chen, X., Guo, M.
Structural Basis for Specific Inhibition of tRNA Synthetase by an ATP Competitive Inhibitor
(2015) Chem. Biol. 22: 1-
PMID: 26074468
Abstract:
Pharmaceutical inhibitors of aminoacyl-tRNA synthetases demand high species and family specificity. The antimalarial ATP-mimetic cladosporin selectively inhibits Plasmodium falciparum LysRS (PfLysRS). How the binding to a universal ATP site achieves the specificity is unknown. Here we report three crystal structures of cladosporin with human LysRS, PfLysRS, and a Pf-like human LysRS mutant. In all three structures, cladosporin occupies the class defining ATP-binding pocket, replacing the adenosine portion of ATP. Three residues holding the methyltetrahydropyran moiety of cladosporin are critical for the specificity of cladosporin against LysRS over other class II tRNA synthetase families. The species-exclusive inhibition of PfLysRS is linked to a structural divergence beyond the active site that mounts a lysine-specific stabilizing response to binding cladosporin. These analyses reveal that inherent divergence of tRNA synthetase structural assembly may allow for highly specific inhibition even through the otherwise universal substrate binding pocket and highlight the potential for structure-driven drug development.
Annotations from the GeneOntology database. Only terms that fit at least two of the interacting proteins are shown. Molecular function:
Biological process:
tRNA aminoacylation for protein translation
The synthesis of aminoacyl tRNA by the formation of an ester bond between the 3'-hydroxyl group of the most 3' adenosine of the tRNA, to be used in ribosome-mediated polypeptide synthesis.
negative regulation of cell proliferation
Any process that stops, prevents or reduces the rate or extent of cell proliferation.
positive regulation of protein modification process
Any process that activates or increases the frequency, rate or extent of the covalent alteration of one or more amino acid residues within a protein.
Cellular component:
membrane
A lipid bilayer along with all the proteins and protein complexes embedded in it an attached to it.
Structural annotations of the participating protein chains.Entry contents: 5 distinct polypeptide molecules
Chains: C, A, B, D, E
Notes: Chains D and E were generated using the biomatrices described in the PDB file.
Name: Aminoacyl tRNA synthase complex-interacting multifunctional protein 2
Source organism: Homo sapiens
Length: 36 residues
Sequence:
Sequence according to PDB SEQRESMPMYQVKPYHGGGAPLRVELPTCMYRLPNVHGRSYG
UniProtKB AC: Q13155 (positions: 1-36) Coverage: 11.3%
UniRef90 AC: UniRef90_Q13155 (positions: 1-36)
Name: Lysine--tRNA ligase
Source organism: Homo sapiens
Length: 505 residues
Sequence:
Sequence according to PDB SEQRESDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE
UniProtKB AC: Q15046 (positions: 72-576) Coverage: 84.6%
UniRef90 AC: UniRef90_Q15046 (positions: 72-576)
Name: Lysine--tRNA ligase
Source organism: Homo sapiens
Length: 505 residues
Sequence:
Sequence according to PDB SEQRESDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE
UniProtKB AC: Q15046 (positions: 72-576) Coverage: 84.6%
UniRef90 AC: UniRef90_Q15046 (positions: 72-576)
Name: Lysine--tRNA ligase
Source organism: Homo sapiens
Length: 505 residues
Sequence:
Sequence according to PDB SEQRESDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE
UniProtKB AC: Q15046 (positions: 72-576) Coverage: 84.6%
UniRef90 AC: UniRef90_Q15046 (positions: 72-576)
Name: Lysine--tRNA ligase
Source organism: Homo sapiens
Length: 505 residues
Sequence:
Sequence according to PDB SEQRESDPNQYYKIRSQAIHQLKVNGEDPYPHKFHVDISLTDFIQKYSHLQPGDHLTDITLKVAGRIHAKRASGGKLIFYDLRGEGVKLQVMANSRNYKSEEEFIHINNKLRRGDIIGVQGNPGKTKKGELSIIPYEITLLSPCLHMLPHLHFGLKDKETRYRQRYLDLILNDFVRQKFIIRSKIITYIRSFLDELGFLEIETPMMNIIPGGAVAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSYKVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKALGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLEVTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQAKAKAAGDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPE
UniProtKB AC: Q15046 (positions: 72-576) Coverage: 84.6%
UniRef90 AC: UniRef90_Q15046 (positions: 72-576)
Evidence demonstrating that the participating proteins are unstructured prior to the interaction and their folding is coupled to binding. Chain C:
The interacting region of the protein has been shown to be highly flexible corresponding to missing coordinates in X-ray structures (PDB ID: 4ycw). The protein region involved in the interaction contains two related conserved motifs (motif 1 and 2) linked by a natural Gly linker and a conserved sequence that makes a 180 degree turn (PMID: 23159739).
Chain A:
tRNA synthetase domain involved in the interaction is known to adopt a stable structure in isolation in tetrameric form (see Pfam domain PF00152). A solved structure of the domain tetramer without bound ligands is represented by PDB ID 3bju.
Chain B:
tRNA synthetase domain involved in the interaction is known to adopt a stable structure in isolation in tetrameric form (see Pfam domain PF00152). A solved structure of the domain tetramer without bound ligands is represented by PDB ID 3bju.
Chain D:
tRNA synthetase domain involved in the interaction is known to adopt a stable structure in isolation in tetrameric form (see Pfam domain PF00152). A solved structure of the domain tetramer without bound ligands is represented by PDB ID 3bju.
Chain E:
tRNA synthetase domain involved in the interaction is known to adopt a stable structure in isolation in tetrameric form (see Pfam domain PF00152). A solved structure of the domain tetramer without bound ligands is represented by PDB ID 3bju.
Structures from the PDB that contain the same number of proteins, and the proteins from the two structures show a sufficient degree of pairwise similarity, i.e. they belong to the same UniRef90 cluster (the full proteins exhibit at least 90% sequence identity) and convey roughly the same region to their respective interactions (the two regions from the two proteins share a minimum of 70% overlap). The structure can be rotated by left click and hold anywhere on the structure. Representation options can be edited by right clicking on the structure window.
Download our modified structure (.pdb)